PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s964352g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family NAC
Protein Properties Length: 385aa    MW: 43473 Da    PI: 6.0576
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s964352g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1631.1e-5051321128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                        lppGfrFhPtd+elv +yLk+k +g k+e+ evi+ +++yk++Pw+Lp k  + +++ +w+fF++rd+ky++g+r+nrat sgyWkatg+d+
  PDK_30s964352g001   5 LPPGFRFHPTDDELVGYYLKRKEDGIKFEF-EVIPVIELYKFDPWELPgKsFLPKRDMQWFFFCPRDRKYPNGSRTNRATGSGYWKATGRDR 95 
                        79**************************99.99***************6434556788********************************** PP

                NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        ++++ ++++ gl+ktLvfy+grap ge+tdWvmheyrl
  PDK_30s964352g001  96 KIIC-ESSVHGLRKTLVFYHGRAPGGERTDWVMHEYRL 132
                        ****.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-583154IPR003441NAC domain
PROSITE profilePS5100555.2465155IPR003441NAC domain
PfamPF023655.5E-286132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MSLSLPPGFR FHPTDDELVG YYLKRKEDGI KFEFEVIPVI ELYKFDPWEL PGKSFLPKRD  60
MQWFFFCPRD RKYPNGSRTN RATGSGYWKA TGRDRKIICE SSVHGLRKTL VFYHGRAPGG  120
ERTDWVMHEY RLCECLPDGS SNFVGAFSLC RIVKRHDNGQ KIGDLQGESR DRKGHSSAMI  180
DFSPKMCFSK VLSTSEENES VVTDLLNRSN GSTRINSPEN LRGTELHQIM IDSDQRDLCG  240
SRVVSDASEV SSPKEGISES MITNMFPISI ETCTPCNPSP ISSYANFREE AYVIDELNGH  300
GCSSSCPSPV YCMDMFSSVE DSTLQSLEWD TPKFMNASLS GTSWSCTVQL KGYSLIPFHW  360
ISEATPFSVC SPTYYDSSCL NISRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-56216117174NAC domain-containing protein 19
3swm_B5e-56216117174NAC domain-containing protein 19
3swm_C5e-56216117174NAC domain-containing protein 19
3swm_D5e-56216117174NAC domain-containing protein 19
3swp_A5e-56216117174NAC domain-containing protein 19
3swp_B5e-56216117174NAC domain-containing protein 19
3swp_C5e-56216117174NAC domain-containing protein 19
3swp_D5e-56216117174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008796307.10.0PREDICTED: protein ATAF2-like
TrEMBLM0RT581e-122M0RT58_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P17780_0011e-122(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-81NAC domain containing protein 71